Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b4xD_

Fold library idPDB HeaderMoleculeTitle
c5b4xD_3.20PDB header: signaling protein/endocytosisChain: D: PDB Molecule: low density lipoprotein receptor-related protein 8,


Added to library: Sat Apr 29 08:43:19 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KECEKDQFQCRNERCIPSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDG
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)



TT
TTS
GGGTTSS


SSSSTTTTT

S
S

TT

SS


GGGTTSSS

STT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SDESEATCTNECLHNNGGCSHICTDLKIGFECTCPAGFQLLDQKTCGDIDECKDPDACSQICVNYKGYFK
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) GGGSSSS



SSSGGGG
SS

SSS


SS

SSS



TTSSTTSSSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence CECYPGYEMDLLTKNCKAAAGKSPSLIFTNRHEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCD
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

TT

TTTT


SS



BS
TTTT


SSTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSYRKIYSAYMDKASDPKEQEVLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRN
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTTTTTTTTSGGG

SS
S


TTTTTTTTTTSS

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence LSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
SSTTTT
SSS
TTS



SS
S
TTTTTTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence SSIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENLNNPHDIVIF
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTS




TTT
SSTTTTTTTTTS





SS


 .........430.........440.........450.........460.........470.........
Sequence HELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGPDMKRCYRA
Predicted secondary structure



















































SS confidence


























































Known secondary structure (DSSP)
GGGS




SSSGGGG
SS


SSSSS
S

TT

TTSS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D