Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b47A_

Fold library idPDB HeaderMoleculeTitle
c5b47A_2.20PDB header: oxidoreductaseChain: A: PDB Molecule: 2-oxoacid--ferredoxin oxidoreductase alpha subunit;


Added to library: Thu Feb 9 21:00:45 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TRIVWMIGGAQGLGVDTSANIFGNAVAKAGYYLFGNREYYSNIKGRHSYFEVVISEKPIRSLSSYVNILA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

TTS
TT


S
SSSSSS





S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SFDAETVFQHFTETKEYLIYNVEYENTTVDLVKSMEPEMAEQVKEALSKERLGFTIKDVLEYLKRRGVKV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
SSGGGGGGTT
BGGG
TTS
TTT

SBTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence IGFNYTELIKKIADTFKVPMSVVERAKNMIAVGASYGLLGLKFDYLKDAISSTFKNELFIKFNTMAAELG
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TT

GGGT



S
 .........220.........230.........240.........250.........260.........270.........280
Sequence YNSVPNVYKLQEYKIEKQRIQVDGNTISAMGKLAGGLRFQSYYPITPASDESVYIEANQNLDMIVEGNEL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS


S







S
TT


T
GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence RKGGVVVVQAEDELAAINMAVGAALTGVRSATATSGPGFSLMSEGISWAGMNEVPVVITYYMRGAPATGL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

SSTT

TT


STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence PTRSGQADLKFALNVGHGEFPRIVIASGDHVEIFWDAIWALNLAEKYQTPVIHIIEKTLANAYSVFEEEL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

TTT
SSS





STS
GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence ITNRPYVIERGKIVKPTSDYFNRFEVTEDGISPRVFLGQASIFYTGDEHNEEGHITENSINRMKMYEKRN
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) GTSS






SB


SSSB

TT


TTS


B

TTTSB



SS
B
TT

B


 .........500.........510.........520.........530.........540.........550.........560
Sequence KKLETADKEIPEEQRVNIVGDADIVLLTWGSPKGAILDAMEELSKDGIKTMMVQVKMFNPYPKNLMKKIL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S
GGGG


SSTTTTT


SS

 .........570.........580.........590.........600.........610.........620.......
Sequence SGKSKIIAVENNYNAQGAEVLAEKTGIFATNYILKWTGRPITREEVIEGIKKILERDEKRVVLYGGA
Predicted secondary structure


























SS confidence


































































Known secondary structure (DSSP) TT
SSSSS




S
SSS




S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D