Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5b1iC_

Fold library idPDB HeaderMoleculeTitle
c5b1iC_3.30PDB header: lyaseChain: C: PDB Molecule: cystathionine beta-synthase;


Added to library: Thu Feb 9 13:58:41 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MLIQHVQELIGHTPLMALPIEVPNHSHIYAKLEMFNPGGSIADRLGAYLIEDGLQRGRVNAKTTIIEPTA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)


SSGGGGSS




S

TTS
GGGSTTSBTTT


TT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence GNTGIGLALATQAHHLRTILVVPEKFSMEKQVLMQALGAEIVHTPSEEGIKGAIRKAEALAATISNSYVP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) STT
TTS
TT

GGGTT
SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence MQFKNPANPAAYYHTLAPEILADMPAPITAFVAGAGSGGTFAGVAAYLQAQDSATKAVVVEPEGSILNGG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTT
TT
SS

S
SSSTT
TTSTT
GGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PAHAHRTEGIGVEFIPPFFDQVRIDQTLTIADNDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




SS
S


SS

GGGGGS




B
TTS
T
 .........290.........300...
Sequence NSHIVTIFPDSSERYLSQKIYTK
Predicted secondary structure












SS confidence






















Known secondary structure (DSSP) T

BBGGGGGGGTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D