Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5az4A_

Fold library idPDB HeaderMoleculeTitle
c5az4A_2.45PDB header: motor proteinChain: A: PDB Molecule: flagellar hook subunit protein;


Added to library: Thu Feb 9 18:27:59 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VAINGDGFFMVSDDGGLTNYLTRSGDFKLDAYGNFVNNAGFVVQGWNINWDDQTIDSSRTPQNIFIDPGM
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

B
SSS

SSSS
S



TTSBTT


BTTTTB

TTS


B

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence HIPAAKSTEVAIKANLNSGLNIGTSSRNLYALDSVHGWNTKTQRAEDENDTGTTQFYTTSKNSVEVTEKG
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

B

S


SSB
TT



B
SSTTTTTT

TT
SS


TTS
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence VDAGSLFNAKGQGLNLRDGQGIWVSYADATYSTNKVGVNAFDPNLQQNQTAAFWGTANQKVNLDITLNGV
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)
BGGG
B
TTSBB



TT

S
S
TT


B

TTS
S



SS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence RIQNADIQSIDDAIAYINTFTAPTDTRDGTGVKAVKNKDGSGIDFVNDNADGTTDNMKNINLVVANTNTA
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)
STTTTS
BTTB





TTSSS
S
S
SSGGGSS
TT

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence GELWNAVWNNNNQTFTFNNNGNGQAGTPTINKNGSSLWTATNITFTPQPPQAATNVQLTGGLNAQIITAH
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) TTTTTSS

SBTTB


S

TTT
SS
TTS

SS
S

 .........360.........370.........380.........390.........400.........410.........420
Sequence KYIYSSNPVDIGPMYNPDGGPAFQPGANATTRPTEPGSAAYWDAVNGGLLNTNVRTFRTTEDLRELLQRD
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP)
SS








TTSSS




SSTTS

SSTTTT
S



B
 .........430.........440.........450.........460.........470.........480.........490
Sequence ARYGVDYDGSGTFAAADINQNIKVVVTADGHFAISNANEQSTVPPNAINGVGNATTTDPKNMSFNITAYS
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) S

TT

SS

GGG

TT
TTS

S


TTSSTT

S






 .........500.........510.........520.........530.........540.........550.........560
Sequence NKQGTVSTNDAFTAIFKAFDGPLVIGNQIKESEQLKLSAFSAGLEIYDSLGSKHTLEVQFVKQSTTQDGG
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT

S


GGG

SSS





TT


SSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NEWQMIIRVPEPAEINTTGEGPNNIIVGTARFNNDGSLASYTPRTINFSPNNGAAPNQQIKLSFGTSGSN
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)

TT
BS
SSSSS
TT
TTS

SB

SSS
S



TT
S
 .........640.........650.........660.........670.........680.........690.........700
Sequence DGLVSSNSASTLTGQATDGYTSGNLKPDAIRVDDKGNILGEFTNGKTFAVAKIAMASVANNSGLEEIGGN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SS

SS

S
B

B
GGG

TTSBTTS

S
SSS

STT
 .........710.........720......
Sequence LFKVTANSGNIVVGEAGTGGRGEMKT
Predicted secondary structure














SS confidence

























Known secondary structure (DSSP)


TTT


TTSSS


B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D