Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5aa6F_

Fold library idPDB HeaderMoleculeTitle
c5aa6F_2.26PDB header: oxidoreductaseChain: F: PDB Molecule: vanadium-dependent bromoperoxidase 2;


Added to library: Thu Feb 9 13:50:02 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QTVNELADMQTRPLLSGSVCRVRDTVDFLSPTKRAKITFKRRIGIAVGELAVGPTCHLNNGDEANIPLFD
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)








TT


SS


S
SS








SSGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence GQFHKSLPHDDMGRVNPEAYQLLLDCIESNDINVCDQVPSGVESDGRKLVNPLGGGGHQVDGADSDNIFI
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TB

TTS
B
TTS
B
T
TTS

SSSSS





TTTT



SSSS
TT
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence KQPDNLLSERLAAQQAEVYWMALLRDIPFSQFGTNNTVQMAVVNLQGFDAFNGLSISRDADGNIDPMQDL
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)




TT
TTTSBGGGTTT
T
TT

STTB


TTS


TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence FRTDWPGVSSGPMVSQFMLANFDIDGIVVEPKAKTLVPEMEYMTGVDTWLNIQNGGPPEDTLFVDEPLFI
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) T
B
STTTTSS
SS
S
TT


B

B
TT

BS
ST






B
SS
B

 .........290.........300.........310.........320.........330.........340.........350
Sequence RNGRDLAALSFNDVLYTEAFRTILIMFNESILAEAGPYGSSTRQEGFTTLGTSHYIHAMAAGSSSTRHAW
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
B

TTT
GGGSSGGGG
SS


BTTBSTTGGG
 .........360.........370.........380.........390.........400.........410.........420
Sequence YAKWQVHRVLRPEAYGGLLHFVINIDDVPLPASIVSNTELLNAVESLNQAQNGGTNQVFLLPMAVGEGSP
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTT
B









T
TS

S




BSSTT
S
 .........430.........440.........450.........460.........470.........480.........490
Sequence VHPAYPSGHAINLGAYLTVLKAFLGFELGQRCFPSPMISNDAGTDRIPFVPSDGDRVGTCINEDGEEEVG
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) SS
SSS

TBB
SS

SSSS




TTS



TTS
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence LTYEGELNKVTSNVAIGRSHLGVHWRMDGVFGAEMGEAGAIRRLQQELGGLPEARDTEGPIPPASYKFRL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
BTTS

TTSGGGS

SSSS




 .........570.........580.........590....
Sequence YSGTMIELFPDNRYMLGDQMCKGFFTGDDFCVPA
Predicted secondary structure






















SS confidence

































Known secondary structure (DSSP) TTS
TTTTTS



TT


B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D