Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c5a7mA_

Fold library idPDB HeaderMoleculeTitle
c5a7mA_1.80PDB header: hydrolaseChain: A: PDB Molecule: beta-xylosidase;


Added to library: Thu Feb 9 15:19:07 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NNQTYANYSAQGQPDLYPETLATLTLSFPDCEHGPLKNNLVCDSSAGYVERAQALISLFTLEELILNTQN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SS


TTT
SS












TTTSTTTTSGGG
TTS
TT

TTBS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGPGVPRLGLPNYQVWNEALHGLDRANFATKGGQFEWATSFPMPILTTAALNRTLIHQIADIISTQARAF
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

BGGGTB




B
TTS
BSS


SSSSTTS






T

 .........150.........160.........170.........180.........190.........200.........210
Sequence SNSGRYGLDVYAPNVNGFRSPLWGRGQETPGEDAFFLSSAYTYEYITGIQGGVDPEHLKVAATVKHFAGY
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TTSS
S


B




STT
TTGGGSS
S
TTTTSSS
SS
SSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence DLENWNNQSRLGFDAIITQQDLSEYYTPQFLAAARYAKSRSLMCAYNSVNGVPSCANSFFLQTLLRESWG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

SSGGG

GGG



TTSTS

S
SSTTGGG
T





T
 .........290.........300.........310.........320.........330.........340.........350
Sequence FPEWGYVSSDCDAVYNVFNPHDYASNQSSAAASSLRAGTDIDCGQTYPWHLNESFVAGEVSRGEIERSVT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TT

TTTTT
SSSST

BBSSSTTSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence RLYANLVRLGYFDKKNQYRSLGWKDVVKTDAWNISYEAAVEGIVLLKNDGTLPLSKKVRSIALIGPWANA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TTTT
TT
TTTT

T


SS

S

TT

STTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence TTQMQGNYYGPAPYLISPLEAAKKAGYHVNFELGTEIAGNSTTGFAKAIAAAKKSDAIIYLGGIDNTIEQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) SGGGG
SS



S



TT


S
SS



TTSS

TTTSB
 .........500.........510.........520.........530.........540.........550.........560
Sequence EGADRTDIAWPGNQLDLIKQLSEVGKPLVVLQMGGGQVDSSSLKSNKKVNSLVWGGYPGQSGGVALFDIL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTB

S

S

TTTSSS
SSS



S
TT




TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence SGKRAPAGRLVTTQYPAEYVHQFPQNDMNLRPDGKSNPGQTYIWYTGKPVYEFGSGLFYTTFKETLALKF
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) TSS





SS
B

TTS
TT



S

SSS





S

SB
TT



SS


 .........640.........650.........660.........670.........680.........690.........700
Sequence NTSSILSAPHPGYTYSEQIPVFTFEANIKNSGKTESPYTAMLFVRTSNAGPAPYPNKWLVGFDRLADIKP
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TTS

TT
SSGGGS
SSS
SSSSSSS

S

T
 .........710.........720.........730.........740.........750.........760
Sequence GHSSKLSIPIPVSALARVDSHGNRIVYPGKYELALNTDESVKLEFELVGEEVTIENWPLE
Predicted secondary structure























SS confidence



























































Known secondary structure (DSSP) T


TTS


TTTT

SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D