Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4zrsA_

Fold library idPDB HeaderMoleculeTitle
c4zrsA_2.00PDB header: hydrolaseChain: A: PDB Molecule: esterase;


Added to library: Sat Feb 6 08:54:42 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GHMTPELRAKLESLGRDLTPEMLGGTTQIFAAMATGSDPEVEVTRDLEYGEDPRHRLDLFRKADTRDAPV
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




SS

TTS



TTSSSSSTT

TT

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVFVHGGGFVMGDKRLAETPFYDNIGVFAAQQGFVGVTITYRLAPAHQFPSGPEDLAAVVRWLKANVAQY
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

STTTS

S

TTS
TTTTS



TTTS
TTGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence GGDPDKIVLSGQAGAAHVASYIAHKAHHATEGGGIAGAILMSGIYDTLTATPNEFLIAYYGDDPKGWGPA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) T


GGG
SSGGGS
SS



TTTS



S
GGG
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence SSMAGLINTEIPLMLTVSEFDPEDFQRQAAQFVCAWGMAHAAYPEMHYLVGHNHLSPAQSIGTEIKAIGR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



S
TT

SS


TT

SSTTTSS

 .........290.
Sequence MVAGFVRRVTR
Predicted secondary structure
SS confidence










Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D