Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4zohA_

Fold library idPDB HeaderMoleculeTitle
c4zohA_2.20PDB header: oxidoreductaseChain: A: PDB Molecule: putative oxidoreductase molybdopterin-binding subunit;


Added to library: Sat Feb 6 08:36:28 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYIGKPIKRIEDLRLITGKGAYVDDIELPGTLFVAFVRSKYPHARIKVKKEEGIFTGEDINPGKDFPIAT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TTS



TTTT


BGGG


TT

SSSS

BTTGGGTSTT

SSS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KETTYVGQPIAIVIAKDRYEAYDLIESVEVEYEELDYVLDPEKALEDKVKVHSGLSSNIYYHERWKGGDV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
STT
SSTT







TT
SS
SSTT
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKAFKEADLTISDTLINQRVIASPLETRGALAYFDGNKLTFYSSTQSAHYLRRNLVDFLGFENIRVIQPD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
S


SS



SS
S
S
T
S


B
 .........220.........230.........240.........250.........260.........270.........280
Sequence VGGAFGSKIIAHPEEYALAKLALMLRKPLKWVPTRTEEFISAGHGRDKKLKFEVAVKKDGTILGIRGTLI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTTSS


S



S

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ANLGAPYPDANDDESGNVKSTVRMLPGIYKIIGADIDAYAVHTNITPTQSYRGAGRPEGIYFIERIVNIV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S

TTTTB




SSS




TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence ADELGIDQYEIRLKNAIDTLPYTNIFGVTYDSGNVKKLLEIGKKYYDELKKEDGCVGVSSYIEITAFGPW
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT

B

SSS
TTS

SS
SSS

B


S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EVARISVKYDGKITLVTGTGPHGQGDATAFAQIAADVLELPIEKIEVRWGDTEIIEDGIGTWGSRTVTIG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

SS

SSS
T

GGG

BTTSSS



S
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GSAVLLASQKLKDKLIEIGAKILNADEYKEGNVTHKKNGNKVTFNEIVKNAFKMGESLDTTAIYNVKQPP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT


TT
TTT


TT




S

 .........570.........580.........590.........600.........610.........620.........630
Sequence TTPYGVHLALVKVDGTGKVFVKKYVAVDDVGTVINPLLAEGQAIGGIVQGMAQALLEGAFFDENGQLLTT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) B


TT


BS
S
T



B
TTS
BS

 .........640.........650.........660.........670.........680.........690.........700
Sequence NFQDYPIPTAVEIPEKIDWYYEILGKSPHPTGSKGIGEAGAIAATPTIINAVEQCIKKRITKMPVKFEEL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) STTTS



GGGS
S


S


SSTT
B


TTTT
S


SSS

GGGG
 .
Sequence V
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D