Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4zohA_

Fold library idPDB HeaderMoleculeTitle
c4zohA_2.20PDB header: oxidoreductaseChain: A: PDB Molecule: putative oxidoreductase molybdopterin-binding subunit;


Added to library: Sat Feb 6 08:36:28 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MYIGKPIKRIEDLRLITGKGAYVDDIELPGTLFVAFVRSKYPHARIKVKKEEGIFTGEDINPGKDFPIAT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

TTS



TTTT


BGGG


TT

SSSS

BTTGGGTSTT

SSS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KETTYVGQPIAIVIAKDRYEAYDLIESVEVEYEELDYVLDPEKALEDKVKVHSGLSSNIYYHERWKGGDV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S
STT
SSTT







TT
SS
SSTT
S
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EKAFKEADLTISDTLINQRVIASPLETRGALAYFDGNKLTFYSSTQSAHYLRRNLVDFLGFENIRVIQPD
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
S


SS



SS
S
S
T
S


B
 .........220.........230.........240.........250.........260.........270.........280
Sequence VGGAFGSKIIAHPEEYALAKLALMLRKPLKWVPTRTEEFISAGHGRDKKLKFEVAVKKDGTILGIRGTLI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



TTTTSS


S



S

TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence ANLGAPYPDANDDESGNVKSTVRMLPGIYKIIGADIDAYAVHTNITPTQSYRGAGRPEGIYFIERIVNIV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

S

TTTTB




SSS




TTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence ADELGIDQYEIRLKNAIDTLPYTNIFGVTYDSGNVKKLLEIGKKYYDELKKEDGCVGVSSYIEITAFGPW
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) TT

B

SSS
TTS

SS
SSS

B


S
 .........430.........440.........450.........460.........470.........480.........490
Sequence EVARISVKYDGKITLVTGTGPHGQGDATAFAQIAADVLELPIEKIEVRWGDTEIIEDGIGTWGSRTVTIG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TT

SS

SSS
T

GGG

BTTSSS



S
TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence GSAVLLASQKLKDKLIEIGAKILNADEYKEGNVTHKKNGNKVTFNEIVKNAFKMGESLDTTAIYNVKQPP
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT


TT
TTT


TT




S

 .........570.........580.........590.........600.........610.........620.........630
Sequence TTPYGVHLALVKVDGTGKVFVKKYVAVDDVGTVINPLLAEGQAIGGIVQGMAQALLEGAFFDENGQLLTT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) B


TT


BS
S
T



B
TTS
BS

 .........640.........650.........660.........670.........680.........690.........700
Sequence NFQDYPIPTAVEIPEKIDWYYEILGKSPHPTGSKGIGEAGAIAATPTIINAVEQCIKKRITKMPVKFEEL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) STTTS



GGGS
S


S


SSTT
B


TTTT
S


SSS

GGGG
 .
Sequence V
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D