Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4zgvB_

Fold library idPDB HeaderMoleculeTitle
c4zgvB_3.20PDB header: transport proteinChain: B: PDB Molecule: ferredoxin receptor;


Added to library: Thu Feb 9 15:22:56 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STPTSQSMGMQIINAEQIKKMPTGNGSVTELLKNNPNVQFSNTASSSNIPGELAPENVSFHGEKFYNNNF
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


TTTS

SS

TGGGGGG
TT
TTSS
TT
TT

S


TT

TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVDGLSNNNNINPGANNGELNQQPDGYSPADLPAGGPQSFWINSELIESLEVFDSNISAKYGDFTGGVVD
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TT
B

SSTTGGGG


SS
TTSSTT





SBSS


SSS
SS

SS

S
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AKTMDPKLDKSSGKISYRTTRDSWTKYHISEVISEEFYSGTNLYYQPKFKKHFYSATFNQPLSDKAGFIF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



SS


STTB




TTTT
STT

SS
SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AYNRQQSDIPYYHEYLQQWDDQERINETYLLKGTYLTDSGDIIRMTGMYSPHESKFYKKDVKNGGFTNSG
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TTTT
TTS



TTBTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence GGYRFNMEWEHNASWGKMTSLAGYQYTEDKTEHEADSYQTWRRFSSGFVSNVIDWSSSGGANGQNSNIGG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)



TTS
SBTT
SS



S


SS

 .........360.........370.........380.........390.........400.........410.........420
Sequence YGSFATNTSSFSLKQDYELNPVSWYGINHQIDFGWETDFYTSRYRRFSDVYTGGVLVVPTGASAGSVVCQ
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)




TT
S






GGGSS




 .........430.........440.........450.........460.........470.........480.........490
Sequence SGDELCIPGEQYSRTRILYPERNVQVSNVNYAAYLQNSMSYGRLEVTPGVRVSYDDFLENLNIAPRFSAS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TT
TTTTTS


TTTTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence YDVFGDRSTRLFGGANRYYAGNILAYKMRQGIGSNIQESRISPTAPWTTPTLRTGTNYNVSDLNTPYSDE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) TSTTS




TSS
S
SSTTS


S






 .........570.........580.........590.........600.........610.........620.........630
Sequence LSLGLSQRVMSTVWTAKWVNRQGKEQFGRETTTIDGQSYRVMNNKGHTEGNTFSLEVEPISPHRFSFAEV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
SSTTSS

SS
 .........640.........650.........660.........670.........680.........690.........700
Sequence NWKLGASVTKNKSNSIYYYDSANQDEQRVIFDDKLMYRGDIDAMNFNTPWRAFLNVNTYFPAVRLSWDQR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S

STT
B

TTS

SSS
GGGS


SS


GGGT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VGYTAGYKGYTTSSIQVQCPGGSSACNGDPSFVGGATEYFPTQYDDFISYDWRFSYSQPVYKTQTLDITL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)



SS
B
SSSSSTTGGGSTT

S
BB



SSSS
 .........780.........790.........800.........
Sequence DVLNVLDNVVETNQTGTSNKPIVIYKPGRQFWLGVAYTW
Predicted secondary structure
















SS confidence






































Known secondary structure (DSSP) SSTT



SBSSS




B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D