Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4z2cA_

Fold library idPDB HeaderMoleculeTitle
c4z2cA_3.19PDB header: isomeraseChain: A: PDB Molecule: dna gyrase subunit a;


Added to library: Thu Feb 9 15:45:57 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QDKNLVNVNLTKEMKASFIDYAMSVIVARALPDVRDGLKPVHRRILYGMNELGVTPDKPHKKSARITGDV
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)

S





TTS
BTTTTB
T

SSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence MGKYHPHGDSSIYEAMVRMAQWWSYRYMLVDGHGNFGSMDGDSAAAQRYTEARMSKIALEMLRDINKNTV
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T

S
TT
TTT
TT
SS



TTS




TTT

TTTTTTTT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence DFVDNYDANEREPLVLPARFPNLLVNGATGIAVGMATNIPPHNLGETIDAVKLVMDNPEVTTKDLMEVLP
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

TTSSSSS


SS


SS





TT

TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence GPDFPTGALVMGKSGIHKAYETGKGSIVLRSRTEIETTKTGRERIVVTEFPYMVNKTKVHEHIVRLVQEK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S


SS


SS

TTS


TT

TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence RIEGITAVRDESNREGVRFVIEVKRDASANVILNNLFKMTQMQTNFGFNMLAIQNGIPKILSLRQILDAY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS



BTTB


TTS
STT
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence IEHQKEVVVRRTRFDKEKAEARAHILEGLLIALDHIDEVIRIIRASETDAEAQAELMSKFKLSERQSQAI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) ST
SST

 .........430.........440.........450.........460.........470.........480.....
Sequence LDMRLRRLTGLERDKIQSEYDDLLALIADLADILAKPERVSQIIKDELDEVKRKFSDKRRTELMV
Predicted secondary structure













SS confidence
































































Known secondary structure (DSSP) T

GGGGSTT





S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D