Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4xt0A_

Fold library idPDB HeaderMoleculeTitle
c4xt0A_2.07PDB header: transferaseChain: A: PDB Molecule: protein ligf;


Added to library: Sat Feb 6 08:37:53 2016
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTLKLYSFGPGANSLKPLATLYEKGLEFEQVFVDPSKFEQHSDWFKKINPRGQVPALWHDGKVVTESTVI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

SSSSTT




GGGTGGGS
TT

S
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence CEYLEDVFPESGNSLRPADPFKRAEMRVWTKWVDEYFCWCVSTIGWAFGIKAIAQKMSDEEFEEHINKNV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTSSS

S
SSTTSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence PIPEQQLKWRRARNGFPQEMLDEEFRKVGVSVARLEETLSKQDYLVDTGYSLADICNFAIANGLQRPGGF
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)




TTSSSSSTT
S
TTTT
TTST
 .........220.........230.........240...
Sequence FGDYVNQEKTPGLCAWLDRINARPAIKEMFEKS
Predicted secondary structure










SS confidence
































Known secondary structure (DSSP) TTTTSSTTT
ST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D