Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4tnil_

Fold library idPDB HeaderMoleculeTitle
c4tnil_PDB header: electron transport,photosynthesisChain: L: PDB Molecule: photosystem ii reaction center protein l;PDBTitle: rt xfel structure of photosystem ii 500 ms after the third2 illumination at 4.6 a resolution


Added to library: Sat Jul 12 08:13:45 2014
 
Links to external resources


 1........10.........20.........30.......
Sequence MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Predicted secondary structure










SS confidence




































Known secondary structure (DSSP)



TT








Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D