Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pz0A_

Fold library idPDB HeaderMoleculeTitle
c4pz0A_PDB header: sugar binding proteinChain: A: PDB Molecule: sugar abc transporter, sugar-binding protein;PDBTitle: the crystal structure of a solute binding protein from bacillus2 anthracis str. ames in complex with quorum-sensing signal3 autoinducer-2 (ai-2)


Added to library: Sat Apr 12 08:32:10 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKKKADDVKFAFIPKLTGVGFFTSGGEGAKEXGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDALXV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

S
GGG

SSSSST



SS

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SSTSVDGLSQSLQRAKKKGXTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEXTSKQIGDKGKVAFFYSS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
SSTTTT
SS


GGG
SS

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PTVTDQNQWVTKAKEIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAXAQA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS

TT
TT

TT


STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AENLKXDKKVVVTGFSTPNVXRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
BTTBB

TTS
S


TS




TT
TTT
 .........290.........300.........310.........320.
Sequence GKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF
Predicted secondary structure




























SS confidence








































Known secondary structure (DSSP)
GGGGT




TT

S


TTTGGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D