Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pz0A_

Fold library idPDB HeaderMoleculeTitle
c4pz0A_PDB header: sugar binding proteinChain: A: PDB Molecule: sugar abc transporter, sugar-binding protein;PDBTitle: the crystal structure of a solute binding protein from bacillus2 anthracis str. ames in complex with quorum-sensing signal3 autoinducer-2 (ai-2)


Added to library: Sat Apr 12 08:32:10 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKKKADDVKFAFIPKLTGVGFFTSGGEGAKEXGDKLGVQVKYDGPSEASVSGQVKYINNFINQNYDALXV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

S
GGG

SSSSST



SS

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SSTSVDGLSQSLQRAKKKGXTVLTWDSDVNPKDRSFYISQGTPDQLANLLIEXTSKQIGDKGKVAFFYSS
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

S
SSTTTT
SS


GGG
SS

TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence PTVTDQNQWVTKAKEIIKEKYPNWEIVTTQYGENNAQKSLSVGENILKTYPDINAVICPDATALPAXAQA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) SS

TT
TT

TT


STT
 .........220.........230.........240.........250.........260.........270.........280
Sequence AENLKXDKKVVVTGFSTPNVXRDYVKRGTVQQFGLWDVKQQGALATYVANEIVVKGKKLKVGDSFEVKGI
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
BTTBB

TTS
S


TS




TT
TTT
 .........290.........300.........310.........320.
Sequence GKVKVEPNSIQGYDYEAEGNGIIVLPERVVFTKDNIDKYNF
Predicted secondary structure




























SS confidence








































Known secondary structure (DSSP)
GGGGT




TT

S


TTTGGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D