Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pyrA_

Fold library idPDB HeaderMoleculeTitle
c4pyrA_PDB header: transport proteinChain: A: PDB Molecule: putative branched-chain amino acid abc transporter;PDBTitle: structure of a putative branched-chain amino acid abc transporter from2 chromobacterium violaceum atcc 12472


Added to library: Sat Apr 26 08:18:43 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KVRIGVILPAESSALGEAAAVVRSGVEAAAQVDQSAELYSVDATGDNVVERYRAAVADGVNVVIGPLSRD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


TTSTT



GGGTT




S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SIVKLAPSVTVPTLALNSVGREAAANPKLYSLSLIVEGEARQLARLXRDDSRAAPLLVVGGDALSQRLGK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGG

S
SS


TTS


TT



TT
SS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence AFADEWRAAAGKPVRQXAFDANDXAPLLQAAGQADAVALALDVAQAARLKSALTPDVPVYGTSQLNVGGX
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SS



TT

T
SS
S
TTS

GGG

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QPELAGVRFIDXPWFLXPAHPAVQRYPRPAAPLTRQTERLYALGIDAYRLAVQLAGSRSGAAVRLDGVTG
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
GGGTT



TTSS


SS


SSS
GGG
TT
 .........290.........
Sequence DLKLGRDRAFERQLPAGVX
Predicted secondary structure











SS confidence


















Known secondary structure (DSSP)
GGGB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D