Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pw0A_

Fold library idPDB HeaderMoleculeTitle
c4pw0A_PDB header: hydrolaseChain: A: PDB Molecule: alpha/beta hydrolase fold protein;PDBTitle: alpha/beta hydrolase fold protein from chitinophaga pinensis


Added to library: Sat Apr 5 10:33:47 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NDHATAPTQYIEVNGTRYAYRSLGAPSDIPLICFQHFTGTLDNWDPLITNGLSKGRQLIIFDNKGVGLSS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

TTT


TTSS

SS


TT

GGGS
TSS


TTSTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence GTTPDNVAAXTADALEFITALGIRYFDVLGFSLGGFIVQYXAHIQPDXIRKIIIVGAAPQGVKVLHTFPD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S


SSTT

ST
GGGS


TT
GGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence LIARAXQLEPKERFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNWGKKTPSFE
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TS


SST


SS





S

SS
 .........220.........230.........240.........250.........260.........270.....
Sequence ITSIQHPVFVVQGSNDEXXDTYNSYELFKQLPDAILSLYPDAAHGSFYQYPELFVSQTEYFLDSY
Predicted secondary structure
























SS confidence
































































Known secondary structure (DSSP) GGG

S
TT
TTT
TSSSTT

TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D