Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pogC_

Fold library idPDB HeaderMoleculeTitle
c4pogC_PDB header: replication, dna binding protein/dnaChain: C: PDB Molecule: cell division control protein 21;PDBTitle: mcm-ssdna co-crystal structure


Added to library: Sat Apr 12 08:21:58 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGIS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)





SS


TTTTSSSS

S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVC
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT









S
GGG

GGGBTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence KDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT



SSS




SS
SSS

S

TTTS

TTTS
TT



G
 .........220.........230.........240.........250.....
Sequence DIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Predicted secondary structure













SS confidence












































Known secondary structure (DSSP) GGTT


TT

TT

SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D