Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4pogC_

Fold library idPDB HeaderMoleculeTitle
c4pogC_PDB header: replication, dna binding protein/dnaChain: C: PDB Molecule: cell division control protein 21;PDBTitle: mcm-ssdna co-crystal structure


Added to library: Sat Apr 12 08:21:58 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVDREEMIERFANFLREYTDEDGNPVYRGKITDLLTITPKRSVAIDWMHLNSFDSELAHEVIENPEEGIS
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)





SS


TTTTSSSS

S
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AAEDAIQIVLREDFQREDVGKIHARFYNLPETLMVKDIGAEHINKLIQVEGIVTRVGEIKPFVSVAVFVC
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTT









S
GGG

GGGBTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence KDCGHEMIVPQKPYESLEKVKKCEQCGSKNIELDVNKSSFVNFQSFRIQDRPETLKGGEMPRFIDGILLD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT



SSS




SS
SSS

S

TTTS

TTTS
TT



G
 .........220.........230.........240.........250.....
Sequence DIVDVALPGDRVIVTGILRVVLEKREKTPIFRKILEVNHIEPVSK
Predicted secondary structure













SS confidence












































Known secondary structure (DSSP) GGTT


TT

TT

SS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D