Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4p8sA_

Fold library idPDB HeaderMoleculeTitle
c4p8sA_PDB header: membrane proteinChain: A: PDB Molecule: reticulon-4 receptor-like 2;PDBTitle: crystal structure of nogo-receptor-2


Added to library: Sat Apr 12 08:49:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIY
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)

S
TT
TTTT
TTS

SS

S


TT



SS



TTSS
TT
S

SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence PGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT





TT




TTTTTT
TT


TTS





TTTTTT
TT


TTS


 .........150.........160.........170.........180.........190.........200.........210
Sequence HLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


TTTTTT
TT


TTS



TTTTTT
TT


TTS



TTTTTT
TT



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRTLRDTDFQ
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)
S


T
TT



SS

SGGG





BSGGGTTSBGGG

GGGGT
 ..
Sequence AC
Predicted secondary structure

SS confidence

Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D