Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4on1B_

Fold library idPDB HeaderMoleculeTitle
c4on1B_PDB header: hydrolaseChain: B: PDB Molecule: putative metalloprotease ii;PDBTitle: crystal structure of metalloproteinase-ii from bacteroides fragilis


Added to library: Sat Apr 12 08:22:18 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PQLEHVLNLRSMDYEDLAGVLSKISNTEHTIMLQEGSELWTTSIKAIHGVEIEESNRPVYLFEGQDKDSI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



TTT

TT
SSS
TT

STTSSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence NAILSQSYATIRLQRGGDLIDYIVYKDKERMAEIANYYQNHYDKIVVCNTGDIKNIRIDITKAIGNNPFK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SSTTSS


S

T
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GLPIKDYPTEATYPATLEFMLIKEKDGGSLEHDITSQIQAVTTSLKFLIDSGFITVKYTIKDSSHKGGAS
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) T
B


S




S

TT



TTTTS
S



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence DYEVSALESFQNYLRSWDEVKGQDKKPYILLRDGTWDSGKTFGYASGIGVIHLNNPRGNFEVAAISTTSS
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)

T
GGGTT
TTS
SS
BTTTTBSS
SS


SSS


TT
S

T
 .........290.........300.........310.........320.........330...
Sequence SHPYTLAHEIGHLLGAEHVDNEQDLMYTWYSPQVTPNHLSADNWVRMLECIQK
Predicted secondary structure
















SS confidence




















































Known secondary structure (DSSP) TSTTT


BS
TTSTTBSB

TT

S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D