Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4o4oB_

Fold library idPDB HeaderMoleculeTitle
c4o4oB_PDB header: lyaseChain: B: PDB Molecule: phycocyanobilin lyase cpct;PDBTitle: crystal structure of phycobiliprotein lyase cpct


Added to library: Sat Aug 9 08:21:54 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence THSTDIATLARWXAADFSNQAQAFENPPFYAHIRVCXRPLPWEVLSGVGFFVEQAYDYXLNDPYRLRVLK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

TT


STTTS



GGGTTSTT
TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LXIVGDRIHIENYTVKQEENFYGASRDLNRLQTLTSESLEKLPGCNXIVEWTGNSFKGTVEPGKGCIVVR
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTGGGGTTTTS
TT

GGG
TT


SSS
SSS

 .........150.........160.........170.........180.........190.......
Sequence KGQKTYLDSEFEINEEKFISLDRGRDLETDAHIWGSVAGPFYFVRLHNFADEVKISA
Predicted secondary structure






























SS confidence
























































Known secondary structure (DSSP) TT
SS

TTT


SS


GGG

S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D