Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nwyA_

Fold library idPDB HeaderMoleculeTitle
c4nwyA_PDB header: isomeraseChain: A: PDB Molecule: protein disulfide-isomerase-like protein of the testis;PDBTitle: crystal structure of the b' domain of human protein disulfide2 isomerase-like protein of the testis (pdilt)


Added to library: Sat Apr 5 08:15:51 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYF
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


TT
TTT

S
TTSTTGGGTTT
TT
GGGT
 .........80.........90.........100.........110.........120........
Sequence RVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYW
Predicted secondary structure
































SS confidence

























































Known secondary structure (DSSP) T

TTS
STTT


S
SS

TT




TTSS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D