Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nuzA_

Fold library idPDB HeaderMoleculeTitle
c4nuzA_PDB header: hydrolaseChain: A: PDB Molecule: endo-beta-n-acetylglucosaminidase f2;PDBTitle: crystal structure of a glycosynthase mutant (d233q) of endos, an endo-2 beta-n-acetyl-glucosaminidase from streptococcus pyogenes


Added to library: Sat Apr 12 08:24:09 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKIPEKIPMKPLHGPLYGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATK
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)












SSGGGSTTT
TT
SS



GGG

TT
S

TT


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence HVPKLNKQGTRVIRTIPWRFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVQVEHD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
GGGGSSSTT
GGGG
TTTS
SSTTTTT
S
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SIPKVDKKEDTAGVERSIQVFEEIGKLIGPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLLLVQVYGS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) G

TT
TTBSTTSSBTTSSS
GGG
TTGGG
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence QGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGFSFYEENAQEGNLWYDINSRKDEDKANGINTDI
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
TTTTS
TTTS
GGG


TT

GGG



S
B

TT
TT

B



 .........290.........300.........310.........320.........330.........340.........350
Sequence TGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKKDATDNIFHSDYSVSKALKTVMLKDKSYD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT



SSS




GGGTTB
B

GGG



GGGS






GGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAIQSLEGLNKFKKLAQLDLIGLSRITKLDRS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) B

TTT

ST
SBTT

S

TT



TTGGG
SS
SS
TT

SGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence VLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAATLTSLEK
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) GS
GGGS






S

SSGGG









TT


TTS

S

TTB
GGG
TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence VDISGNKLDLAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDLQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SS




TTST


TTT


B



B

SS




S
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence SQLLFGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTTDKTLAT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S


TT


ST
TT
B
TT

S


TT
TT



S
 .........640.........650.........660.........670.........680.........690.........700
Sequence DKEETYKVDFFSPADKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSADPVNARKVFDGQLGSETDNISL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS

TT
TTSSS




TTTT
SSS
GGGGSSS


TTS

B
 .........710.........720.........730.........740.........750.........760.........770
Sequence GWDSKQSIIFKLKEDGLIKHWRFFNDSARNPETTNKPIQEASLQIFNIKDYNLDNLLENPNKFDDEKYWI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SSS
SS

GGGT
TT

S


S
TTTS

TTTT
SGGG
 .........780.........790.........800.........810.........820.........830.........840
Sequence TVDTYSAQGERATAFSNTLNNITSKYWRVVFDTKGDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SS

S

S



TT


B
S

TTT
 .........850.........860.........870.........880........
Sequence QQKDKFSQKMLDELKIKEMALETSLNSKIFDVTAINANAGVLKDCIEK
Predicted secondary structure











SS confidence















































Known secondary structure (DSSP) T
TTTS
T
SS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D