Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nuzA_

Fold library idPDB HeaderMoleculeTitle
c4nuzA_PDB header: hydrolaseChain: A: PDB Molecule: endo-beta-n-acetylglucosaminidase f2;PDBTitle: crystal structure of a glycosynthase mutant (d233q) of endos, an endo-2 beta-n-acetyl-glucosaminidase from streptococcus pyogenes


Added to library: Sat Apr 12 08:24:09 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKIPEKIPMKPLHGPLYGGYFRTWHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSLFWKELATK
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)












SSGGGSTTT
TT
SS



GGG

TT
S

TT


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence HVPKLNKQGTRVIRTIPWRFLAGGDNSGIAEDTSKYPNTPEGNKALAKAIVDEYVYKYNLDGLDVQVEHD
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TT
GGGGSSSTT
GGGG
TTTS
SSTTTTT
S
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence SIPKVDKKEDTAGVERSIQVFEEIGKLIGPKGVDKSRLFIMDSTYMADKNPLIERGAPYINLLLVQVYGS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) G

TT
TTBSTTSSBTTSSS
GGG
TTGGG
S

 .........220.........230.........240.........250.........260.........270.........280
Sequence QGEKGGWEPVSNRPEKTMEERWQGYSKYIRPEQYMIGFSFYEENAQEGNLWYDINSRKDEDKANGINTDI
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
TTTTS
TTTS
GGG


TT

GGG



S
B

TT
TT

B



 .........290.........300.........310.........320.........330.........340.........350
Sequence TGTRAERYARWQPKTGGVKGGIFSYAIDRDGVAHQPKKYAKKDATDNIFHSDYSVSKALKTVMLKDKSYD
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TT



SSS




GGGTTB
B

GGG



GGGS






GGGS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LIDEKDFPDKALREAVMAQVGTRKGDLERFNGTLRLDNPAIQSLEGLNKFKKLAQLDLIGLSRITKLDRS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) B

TTT

ST
SBTT

S

TT



TTGGG
SS
SS
TT

SGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence VLPANMKPGKDTLETVLETYKKDNKEEPATIPPVSLKVSGLTGLKELDLSGFDRETLAGLDAATLTSLEK
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) GS
GGGS






S

SSGGG









TT


TTS

S

TTB
GGG
TT

 .........500.........510.........520.........530.........540.........550.........560
Sequence VDISGNKLDLAPGTENRQIFDTMLSTISNHVGSNEQTVKFDKQKPTGHYPDTYGKTSLRLPVANEKVDLQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

SS




TTST


TTT


B



B

SS




S
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence SQLLFGTVTNQGTLINSEADYKAYQNHKIAGRSFVDSNYHYNNFKVSYENYTVKVTDSTLGTTTDKTLAT
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) S


TT


ST
TT
B
TT

S


TT
TT



S
 .........640.........650.........660.........670.........680.........690.........700
Sequence DKEETYKVDFFSPADKTKAVHTAKVIVGDEKTMMVNLAEGATVIGGSADPVNARKVFDGQLGSETDNISL
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SS

TT
TTSSS




TTTT
SSS
GGGGSSS


TTS

B
 .........710.........720.........730.........740.........750.........760.........770
Sequence GWDSKQSIIFKLKEDGLIKHWRFFNDSARNPETTNKPIQEASLQIFNIKDYNLDNLLENPNKFDDEKYWI
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
SSS
SS

GGGT
TT

S


S
TTTS

TTTT
SGGG
 .........780.........790.........800.........810.........820.........830.........840
Sequence TVDTYSAQGERATAFSNTLNNITSKYWRVVFDTKGDRYSSPVVPELQILGYPLPNADTIMKTVTTAKELS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

SS

S

S



TT


B
S

TTT
 .........850.........860.........870.........880........
Sequence QQKDKFSQKMLDELKIKEMALETSLNSKIFDVTAINANAGVLKDCIEK
Predicted secondary structure











SS confidence















































Known secondary structure (DSSP) T
TTTS
T
SS

T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D