Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nooA_

Fold library idPDB HeaderMoleculeTitle
c4nooA_PDB header: immune systemChain: A: PDB Molecule: vgrg protein;PDBTitle: molecular mechanism for self-protection against type vi secretion2 system in vibrio cholerae


Added to library: Sat Apr 12 08:17:46 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence IWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQXSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNV
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTGGGTTT

TT

SSTT

TTTTTTTTSTTGGGGTT

TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence VWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALN
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) STTTT



S
B
TT

TT
 .........150.........160.........170.........180.........190.........200
Sequence GQNXESXTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVD
Predicted secondary structure



















SS confidence



























































Known secondary structure (DSSP) T

STT

TTTT
GGGTT
B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D