Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nesA_

Fold library idPDB HeaderMoleculeTitle
c4nesA_PDB header: isomeraseChain: A: PDB Molecule: udp-n-acetylglucosamine 2-epimerase;PDBTitle: crystal structure of methanocaldococcus jannaschii udp-glcnac 2-2 epimerase in complex with udp-glcnac and udp


Added to library: Sat Apr 26 08:22:57 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKLSIILGTRPEIIKLSPIIRALEKTNIDWHIIHTNQHYSENXDKIFFEELNLPNPKYNLNIGSGTHGEQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


STTS




S

SGGGTTT



S






 .........80.........90.........100.........110.........120.........130.........140
Sequence TGKXLIEIEKVLLKEKPDVVVVQGDTNTVLAGALVASKLKIDVAHVEAGLRSFDRNXPEEINRVLTDHIS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SSSSTT
S




S
TTST
 .........150.........160.........170.........180.........190.........200.........210
Sequence SYLFAPTEIAKNNLLREGIEENKIFVVGNTIVDATLQNLKIAEKNENVRAFFNSVVDDYFLLTLHRAENV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) SSSTT

GGG


T






 .........220.........230.........240.........250.........260.........270.........280
Sequence DNKERLKNIVEGIFEIIEIYDKAIIFSIHPRTKKRLKEFNLFDKLKSNKKIKIIEPVGYLEFLXLEKNAE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SS



TT

TT




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LILTDSGGVQEEACILKVPCITLRDNTERPETVEVGANILVGDNKEKLIKAVEIXLNKKRNWKNPFGNGK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

T


SS

S
TTTS
TT
T

S



TT
SS
 .........360..
Sequence SGERIVRILTYG
Predicted secondary structure


SS confidence











Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D