Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4nesA_

Fold library idPDB HeaderMoleculeTitle
c4nesA_PDB header: isomeraseChain: A: PDB Molecule: udp-n-acetylglucosamine 2-epimerase;PDBTitle: crystal structure of methanocaldococcus jannaschii udp-glcnac 2-2 epimerase in complex with udp-glcnac and udp


Added to library: Sat Apr 26 08:22:57 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XKLSIILGTRPEIIKLSPIIRALEKTNIDWHIIHTNQHYSENXDKIFFEELNLPNPKYNLNIGSGTHGEQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


STTS




S

SGGGTTT



S






 .........80.........90.........100.........110.........120.........130.........140
Sequence TGKXLIEIEKVLLKEKPDVVVVQGDTNTVLAGALVASKLKIDVAHVEAGLRSFDRNXPEEINRVLTDHIS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

SSSSTT
S




S
TTST
 .........150.........160.........170.........180.........190.........200.........210
Sequence SYLFAPTEIAKNNLLREGIEENKIFVVGNTIVDATLQNLKIAEKNENVRAFFNSVVDDYFLLTLHRAENV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) SSSTT

GGG


T






 .........220.........230.........240.........250.........260.........270.........280
Sequence DNKERLKNIVEGIFEIIEIYDKAIIFSIHPRTKKRLKEFNLFDKLKSNKKIKIIEPVGYLEFLXLEKNAE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) SS



TT

TT




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LILTDSGGVQEEACILKVPCITLRDNTERPETVEVGANILVGDNKEKLIKAVEIXLNKKRNWKNPFGNGK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

T


SS

S
TTTS
TT
T

S



TT
SS
 .........360..
Sequence SGERIVRILTYG
Predicted secondary structure


SS confidence











Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D