Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mowB_

Fold library idPDB HeaderMoleculeTitle
c4mowB_PDB header: oxidoreductaseChain: B: PDB Molecule: glucose 1-dehydrogenase;PDBTitle: crystal structure of a putative glucose 1-dehydrogenase from2 burkholderia cenocepacia j2315


Added to library: Sat Sep 28 09:02:40 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSKLAGKVAIVTGASKGIGAAIAKALADEGAAVVVNYASSKAGADAVVSAITEAGGRAVAVGGDVSKAAD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)

TTTT
SS
SSTT
SS
TT



TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AQRIVDTAIETYGRLDVLVNNSGVYEFAPIEAITEEHYRRQFDTNVFGVLLTTQAAVKHLGEGASIINIS
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) S











GGG

TTT

TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SVVTSITPPASAVYSGTKGAVDAITGVLALELGPRKIRVNAINPGMIVTEGTHSAGSDLEAQVLGQTPLG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
T

TT
GGGT


B

TT

T
TTS
 .........220.........230.........240.....
Sequence RLGEPNDIASVAVFLASDDARWMTGEHLVVSGGLN
Predicted secondary structure















SS confidence


































Known secondary structure (DSSP) S
B
SGGGTT

S
STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D