Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mouA_

Fold library idPDB HeaderMoleculeTitle
c4mouA_PDB header: isomeraseChain: A: PDB Molecule: enoyl-coa hydratase/isomerase family protein;PDBTitle: crystal structure of an enoyl-coa hydratase/isomerase family member,2 nysgrc target 028282


Added to library: Sat Sep 28 08:43:51 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARPRTGRISVAIADGVASVEISNLAQRNALTKDXCLEIQELXPQLDADPDVAVVVLRGAGDTFCAGASIS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





TT
GGGTT
B

TT
SSTT

B

B
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELASVLLDPQPDGSTADHLSRADSAIAALSKPAVALVDGACXGGGWQIASACDFIIANERAVIGLTPAKI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GS
TTS

T
SS

STTSSTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence GIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSX
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T






TSSS
GGGS
 .........220.........230.........240.........250.........260.
Sequence HSXKRLVDLTDSGIDQEWAAAWSAXPDSPDXGIGISAFLNREQPRFXWRPA
Predicted secondary structure












SS confidence


















































Known secondary structure (DSSP) TT

STTS









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D