Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mouA_

Fold library idPDB HeaderMoleculeTitle
c4mouA_PDB header: isomeraseChain: A: PDB Molecule: enoyl-coa hydratase/isomerase family protein;PDBTitle: crystal structure of an enoyl-coa hydratase/isomerase family member,2 nysgrc target 028282


Added to library: Sat Sep 28 08:43:51 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARPRTGRISVAIADGVASVEISNLAQRNALTKDXCLEIQELXPQLDADPDVAVVVLRGAGDTFCAGASIS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)





TT
GGGTT
B

TT
SSTT

B

B
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELASVLLDPQPDGSTADHLSRADSAIAALSKPAVALVDGACXGGGWQIASACDFIIANERAVIGLTPAKI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GS
TTS

T
SS

STTSSTT


 .........150.........160.........170.........180.........190.........200.........210
Sequence GIIYPRPGLERLVRLVGHANAKYILLTGQTFSAPEARALGLVADVVPSESFEEKCAALVRSLRSRSRFSX
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T






TSSS
GGGS
 .........220.........230.........240.........250.........260.
Sequence HSXKRLVDLTDSGIDQEWAAAWSAXPDSPDXGIGISAFLNREQPRFXWRPA
Predicted secondary structure












SS confidence


















































Known secondary structure (DSSP) TT

STTS









Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D