Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mo1B_

Fold library idPDB HeaderMoleculeTitle
c4mo1B_PDB header: transcription regulatorChain: B: PDB Molecule: antitermination protein q;PDBTitle: crystal structure of antitermination protein q from bacteriophage2 lambda. northeast structural genomics consortium target or18a.


Added to library: Sat Sep 28 08:22:23 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DKQKAINYLXQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRSAATPGARCRDCHGTGRAVDIA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
GGG
T

STTSB
TTTTTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence KTELWGRVVEKECGRCKGVGYSRXPASAAYRAVTXLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNI
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TS


TTTTT

B




TTSTT

T
 ...
Sequence LNA
Predicted secondary structure

SS confidence


Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D