Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mnuA_

Fold library idPDB HeaderMoleculeTitle
c4mnuA_PDB header: transcription regulatorChain: A: PDB Molecule: slya-like transcription regulator;PDBTitle: crystal structure of uncharacterized slya-like transcription regulator2 from listeria monocytogenes


Added to library: Sat Sep 28 08:50:46 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AXKDILRDIGVIARALDSISNIEFKELNLAKGQFIYLVRICENQGIIQEKLVDILKIDRTTASRAIKNLE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)




TGGGT
TTTSTTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence KNGLIIKKQNKNNKKNKLLFPTEKGQQLYPLIIRENEYSNAVALKGFTEAEINXLTDALKKVKENIADDW
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTS

TT
TTS

TTT

 .........150.
Sequence LYVKKGNKRSY
Predicted secondary structure





SS confidence










Known secondary structure (DSSP) TT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D