Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mnrA_

Fold library idPDB HeaderMoleculeTitle
c4mnrA_PDB header: transferaseChain: A: PDB Molecule: peptidoglycan glycosyltransferase;PDBTitle: crystal structure of d,d-transpeptidase domain of peptidoglycan2 glycosyltransferase from eggerthella lenta


Added to library: Sat Sep 28 08:44:44 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARSERGTIATYDGVVLARSVKEEDGTYEREYPAGDLASHVVGYSSPQFGNSGIEKAYNDTLKGTAGNDVT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S




TT


TTS

TTTTTT

TTT
T




 .........80.........90.........100.........110.........120.........130.........140
Sequence LTLNSKIQQAAQDALAGRKGACVVXDPDTGAILAXASAPTYNAADFAAVIEQANANPDDSTLVDRAAGSL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TTS

TTT
BS


GGG
TT

TT


SSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence YAPGSTFKIVTLATALEDDVAGEDTVFSSPGTXEIGNATVSNFNKANYGSLTLAQATELSSNTVFGQLGV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) B

GGGGTTS

TT

STT
GGG


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence EXGADKLVAGAESFGFNKEIDFPLYTPESLXPSAEDLQKSPWELAWAAAGEPVGDTTRPGRESPAGPQAT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTTT




SS




B



TT




TTSTT

S

S
BB
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLEXAXVGTAIANDGVIXQPYLVDSVNNANGERSFSASPTKLXQAVSKTTAGRVRDVLLGVVQNGTGTAA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTT

B

TTS





S
STTGGG
 .........360.........370.........380.........390.........400.........410.......
Sequence AIPGIDVAGKTGTAEKENGNDSWFVGXAPAEDPRVVVAIVIEDGEEGVGTAKAQNVLKTALEVQGLL
Predicted secondary structure



























SS confidence


































































Known secondary structure (DSSP)
BTTB

TTSTTS
STT

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D