Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mnrA_

Fold library idPDB HeaderMoleculeTitle
c4mnrA_PDB header: transferaseChain: A: PDB Molecule: peptidoglycan glycosyltransferase;PDBTitle: crystal structure of d,d-transpeptidase domain of peptidoglycan2 glycosyltransferase from eggerthella lenta


Added to library: Sat Sep 28 08:44:44 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ARSERGTIATYDGVVLARSVKEEDGTYEREYPAGDLASHVVGYSSPQFGNSGIEKAYNDTLKGTAGNDVT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S




TT


TTS

TTTTTT

TTT
T




 .........80.........90.........100.........110.........120.........130.........140
Sequence LTLNSKIQQAAQDALAGRKGACVVXDPDTGAILAXASAPTYNAADFAAVIEQANANPDDSTLVDRAAGSL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) S

TTS

TTT
BS


GGG
TT

TT


SSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence YAPGSTFKIVTLATALEDDVAGEDTVFSSPGTXEIGNATVSNFNKANYGSLTLAQATELSSNTVFGQLGV
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) B

GGGGTTS

TT

STT
GGG


T
 .........220.........230.........240.........250.........260.........270.........280
Sequence EXGADKLVAGAESFGFNKEIDFPLYTPESLXPSAEDLQKSPWELAWAAAGEPVGDTTRPGRESPAGPQAT
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) TTTT




SS




B



TT




TTSTT

S

S
BB
 .........290.........300.........310.........320.........330.........340.........350
Sequence VLEXAXVGTAIANDGVIXQPYLVDSVNNANGERSFSASPTKLXQAVSKTTAGRVRDVLLGVVQNGTGTAA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTT

B

TTS





S
STTGGG
 .........360.........370.........380.........390.........400.........410.......
Sequence AIPGIDVAGKTGTAEKENGNDSWFVGXAPAEDPRVVVAIVIEDGEEGVGTAKAQNVLKTALEVQGLL
Predicted secondary structure



























SS confidence


































































Known secondary structure (DSSP)
BTTB

TTSTTS
STT

TTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D