Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mlqA_

Fold library idPDB HeaderMoleculeTitle
c4mlqA_PDB header: transferaseChain: A: PDB Molecule: porphobilinogen deaminase;PDBTitle: crystal structure of bacillus megaterium porphobilinogen deaminase


Added to library: Sat Apr 5 08:20:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



SSTT

S

TTS
SGGG

SS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

S




TT


GGGS
TT



SS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS
STT
STTT
S

TTT



TTTT
TT
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence ERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

TTSS
TTS

TTSS
S
T
 .........
Sequence LIDRVKEEL
Predicted secondary structure
SS confidence








Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D