Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mlqA_

Fold library idPDB HeaderMoleculeTitle
c4mlqA_PDB header: transferaseChain: A: PDB Molecule: porphobilinogen deaminase;PDBTitle: crystal structure of bacillus megaterium porphobilinogen deaminase


Added to library: Sat Apr 5 08:20:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SHMRKIIVGSRRSKLALTQTKWVIEQLKKQGLPFEFEIKEMVKEIEQAMLDKEIDMAVHSMKDMPAVLPE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)



SSTT

S

TTS
SGGG

SS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence GLTIGCIPLREDHRDALISKNGERFEELPSGAVIGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T

S




TT


GGGS
TT



SS


S
 .........150.........160.........170.........180.........190.........200.........210
Sequence EDYDAIILAAAGLSRMGWSKDTVTQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRA
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS
STT
STTT
S

TTT



TTTT
TT
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence ERVFLKEMEGGCQVPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGKDPIAIGSEAAERLTSQGAKL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TT

TTSS
TTS

TTSS
S
T
 .........
Sequence LIDRVKEEL
Predicted secondary structure
SS confidence








Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D