Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mi0A_

Fold library idPDB HeaderMoleculeTitle
c4mi0A_PDB header: transferaseChain: A: PDB Molecule: histone-lysine n-methyltransferase ezh2;PDBTitle: human enhancer of zeste (drosophila) homolog 2(ezh2)


Added to library: Sat Sep 28 08:27:24 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCG
Predicted secondary structure



































































SS confidence





































































Known secondary structure (DSSP)





TT

SSTTSTT

B
TT

S
TT
TTB





SSB

STTSTTB


TTT

SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence AADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVKY
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT
TT

SS
SBSS
T




SSSSSS
B
TT


S


 .........150.........160.........170.........180.........190.........200........
Sequence MCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYS
Predicted secondary structure




































SS confidence



































































Known secondary structure (DSSP) SS


SSS
TTT

GGGGS
SS
STTSS
B
TT
B

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D