Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mhcA_

Fold library idPDB HeaderMoleculeTitle
c4mhcA_PDB header: structural proteinChain: A: PDB Molecule: nucleoporin nup157;PDBTitle: crystal structure of a nucleoporin


Added to library: Sat Sep 28 08:26:35 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SEPLQLASEFVQDLSFRDRNTPILDNPDYYSKGLDYNFSDEVGGLGAFTPFQRQQVTNIPDEVLSQVSNT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

T


S

GGGSTT

SSTTTTGGG



TTTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence EIKSDMGIFLELNYCWITSDNKLILWNINNSSEYHCIDEIEHTILKVKLVKPSPNTFVSSVENLLIVATL
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SS
TTTTTTTTTSS




S



TTSTTTTSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FDIYILTISFNDRTHELNIFNTGLKVNVTGFNVSNIISYERTGQIFFTGATDGVNVWELQYNKICLTKSN
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
SSS


TTT
TTTTTTSTT






SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LEETISQLEVDQSRGVLHTLSTKSIVRSYLITSNGLVGPVLIDAAHIRRGMNALGVKNSPLLSNRAFKIA
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


STTTTTTS
TT
T



GGGSTTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence KIVSISMCENNDLFLAVITTTGVRLYFKGSISRRSIGSLKLDSVKFPPTSGPLSTQKASSTYINTTCAST
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

TTT
SSTT



TT








TTT

TT
SB
TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IISPGIYFTCVRKRAEHKLYVSAPDYGILKNYGKYVENTALLDTTDEIKEIVPLTRSFNYTSTPQGYANV
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) TTT




S


S

S
SS



S
SSSTTTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence FASQYSAEPLKVAVLTSNALEIYCYRTPDEVFESLIENPLPFIHSYGLSEACSTALYLACKFNKSEHIKS
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTTS


SS

TTT



SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence SALAFFSAGIPGVVEIKPKSVLSPRFYGSALLITRLFSQIWEERVFVGISITRPQVEYYLSSISVLADFF
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
BTTTB








TTTTTTSBSB

BSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence NIHRPSFVSTASDAESIAMNALILLINSIKDALSLINVFYEDIDAFKSLLNTLMYDSKTREYFFDLKFHD
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) SGGGT


GGG


T
B
 .........640.........650.........660.........670.
Sequence LFTPNAKTKQLIKEILIEVVNANIASGTSADYIVNVLKERF
Predicted secondary structure











SS confidence








































Known secondary structure (DSSP) S

TT
S
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D