Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mg4G_

Fold library idPDB HeaderMoleculeTitle
c4mg4G_PDB header: unknown functionChain: G: PDB Molecule: phosphonomutase;PDBTitle: crystal structure of a putative phosphonomutase from burkholderia2 cenocepacia j2315


Added to library: Sat Sep 28 08:23:06 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GNNEKGAIFRSLHRAGQPLALFNVWDAGSARVVADAGAVALATGSWSVAAANGFVDGEQMPRALMMEVLE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
T

TTS



B
STT
SSB
TT

TTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIVRATDLPVTVDLESGYGERPEDVAETIAMSIRAGAIGCNLEDSFPSTGELRDVDEAAARIAAARQAAD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS

TT
S
SSTT
S
B
TTT

B

 .........150.........160.........170.........180.........190.........200.........210
Sequence RAGVDYFINARTDVFFKAATETHDERLLDATLARARAYAAAGADGLFVPGLRSPALIRALTAASPLPVNV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT




S
GGG
ST
S
TT



SS
 .........220.........230.........240.........250..
Sequence MRVAETPTLAELAEYGVARISHGPYPYLQAMKTLAALVKQGG
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP)

SSSS
TT
S
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D