Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mg4G_

Fold library idPDB HeaderMoleculeTitle
c4mg4G_PDB header: unknown functionChain: G: PDB Molecule: phosphonomutase;PDBTitle: crystal structure of a putative phosphonomutase from burkholderia2 cenocepacia j2315


Added to library: Sat Sep 28 08:23:06 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GNNEKGAIFRSLHRAGQPLALFNVWDAGSARVVADAGAVALATGSWSVAAANGFVDGEQMPRALMMEVLE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
T

TTS



B
STT
SSB
TT

TTT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIVRATDLPVTVDLESGYGERPEDVAETIAMSIRAGAIGCNLEDSFPSTGELRDVDEAAARIAAARQAAD
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)
SS

TT
S
SSTT
S
B
TTT

B

 .........150.........160.........170.........180.........190.........200.........210
Sequence RAGVDYFINARTDVFFKAATETHDERLLDATLARARAYAAAGADGLFVPGLRSPALIRALTAASPLPVNV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT




S
GGG
ST
S
TT



SS
 .........220.........230.........240.........250..
Sequence MRVAETPTLAELAEYGVARISHGPYPYLQAMKTLAALVKQGG
Predicted secondary structure













SS confidence









































Known secondary structure (DSSP)

SSSS
TT
S
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D