Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4me9B_

Fold library idPDB HeaderMoleculeTitle
c4me9B_PDB header: transcription regulatorChain: B: PDB Molecule: transcriptional regulator, tetr family;PDBTitle: crystal structure of a transcriptional regulator, tetr family2 (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution


Added to library: Sat Sep 28 10:48:08 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KNKQEDIFDAAXQLFAERGYDGTTIPXIAEKAKVGAGTIYRYFENKEALVNSLFSKSXLQLSEXIKTDFP
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)

TTT

TS

SSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence VEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFXNIIEDGIVKGLLRPL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTS
T
TT
TT

TTSB
SS
 .........150.........160.........170.........180......
Sequence PPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEESSWNAIRII
Predicted secondary structure









SS confidence













































Known secondary structure (DSSP)
TTSS


B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D