Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4mb1A_

Fold library idPDB HeaderMoleculeTitle
c4mb1A_PDB header: hydrolaseChain: A: PDB Molecule: oligo-1,6-glucosidase 1;PDBTitle: the structure of mall mutant enzyme g202p from bacillus subtilus


Added to library: Sat Sep 28 08:46:57 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EWWKEAVVYQIYPRSFYDANGDGFGDLQGVIQKLDYIKNLGADVIWLSPVFDSPQDDNGYDISDYKNMYE
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
TTTS


GGGT

SSSSSS

T







TTTTSS
S
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence KFGTNEDMFQLIDEVHKRGMKIVMDLVVNHTSDEHAWFAESRKSKDNPYRDYYLWKDPKPDGSEPNNWGS
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

TT


SB

TTSTT
TTSTTGGGB



TTS

SS
BB
 .........150.........160.........170.........180.........190.........200.........210
Sequence IFSGSAWTYDEGTGQYYLHYFSKKQPDLNWENEAVRREVYDVMRFWMDRGVDGWRMDVIPSISKYTDFPD
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTSSBSTTTT
SS
TTS
BB
TTSTT

TTGGGSS

TT


 .........220.........230.........240.........250.........260.........270.........280
Sequence YETDHSRSYIVGRYHSNGPRLHEFIQEMNREVLSHYDCMTVGEANGSDIEEAKKYTDASRQELNMIFTFE
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)



SS
SSB

GGGSS
TTTGGGSS

TT


GGG
S
S
ST
 .........290.........300.........310.........320.........330.........340.........350
Sequence HMDIDKEQNSPNGKWQIKPFDLIALKKTMTRWQTGLMNVGWNTLYFENHDQPRVISRWGNDRKLRKECAK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTSTTB
SS
TTGGGSB



TSSSS
B
S

TTS

S

STT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AFATVLHGMKGTPFIYQGEEIGMVNSDMPLEMYDDLEIKNAYRELVVENKTMSEKEFVKAVMIKGRDHAR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) TSSSTTGGGT






GGG


TTTS
SS

GGGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence TPMQWDAGKHAGFTAGDPWIPVNSRYQDINVKESLEDQDSIFFYYQKLIQLRKQYKIMIYGDYQLLQEND
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) S



SSSGGGGS
SS

SS


TTTTTSS
TTS
T


STT
 .........500.........510.........520.........530.........540.........550.......
Sequence PQVFSYLREYRGEKLLVVVNLSEEKALFEAPPELIHERWKVLISNYPQADLKSISLKPYEAVMGISI
Predicted secondary structure





























SS confidence


































































Known secondary structure (DSSP) SSTT
SSS


GGGTT

SS



TT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D