Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4lxrA_

Fold library idPDB HeaderMoleculeTitle
c4lxrA_PDB header: immune system/cytokineChain: A: PDB Molecule: protein toll;PDBTitle: structure of the toll - spatzle complex, a molecular hub in drosophila2 development and innate immunity


Added to library: Sat Apr 12 09:55:31 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIG
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)

ST
SSTTSTT
SS
ST

SSGGGGGGS
SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence EVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPA
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP) S



TTS
TT

S
S

SS


GGGGTT
TT
S

S




T
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLT
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP) TTTTT
TT
SS





GGGGTT
TT



SS


S

TT
GGG
TT



SS





 .........220.........230.........240.........250.........260.........270.........280
Sequence KHDFEGATSVLGIDIHDNGIEQLPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPL
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) GGGGTT
TT



SS





TTTTTT
TT



S


S


TTTTTT
TT




SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence ATLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNR
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)



TTTT
S
TT


S





TTTTTT
TT



SS

S


TTTTTT
TT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLDH
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S


TTTTSS
TT



SS



SSTTTT
TT



SS



TTTTSS
TT



S
 .........430.........440.........450.........460.........470.........480.........490
Sequence NDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLRELDLSYNNISSLGYEDL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S


TT

TT




GGGG
TT



SS


S

T
TT


TTS



GGGG
 .........500.........510.........520.........530.........540.........550.........560
Sequence AFLSQNRLHVNMTHNKIRRIALPEDVNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTD
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)




S


TTS





S







S


SGGGSSS


SGGGT
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence RLVCSQPNVLEGTPVRQIEPQTLICPLDFSKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQ
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP) T
BSTTTTT
BGGG

GGG







TT
TTTT


S

SS







TT

 .........640.........650.........660.........670.........680.........690.........700
Sequence LMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVLGFLNW
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)
TTS






TTSTTGGG
S
TT






GGGS
TT



SS







 .........710.........720.........730.........740.........750.....
Sequence RSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAPTRMVELSTNDICP
Predicted secondary structure



























SS confidence






















































Known secondary structure (DSSP)

TTS
B

SGGGT
TTTBTTGGG




GGG




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D