Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ls5A_

Fold library idPDB HeaderMoleculeTitle
c4ls5A_PDB header: transferaseChain: A: PDB Molecule: 3-oxoacyl-[acyl-carrier-protein] synthase 2;PDBTitle: crystal structure of beta-ketoacyl-acp synthase ii (fabf) from2 bacillus subtilis


Added to library: Sat Apr 5 09:21:17 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTKKRVVVTGLGALSPLGNDVDTSWNNAINGVSGIGPITRVDAEEYPAKVAAELKDFNVEDYMDKKEARK
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)




BTTBSSTTT




SS
GGGSS



SS

GGGTS
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MDRFTQYAVVAAKMAVEDADLNITDEIAPRVGVWVGSGIGGLETLESQFEIFLTKGPRRVSPFFVPMMIP
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) S
T



TTTGGG
SS
S
GGGS
TTST
 .........150.........160.........170.........180.........190.........200.........210
Sequence DMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSFAGFSANKALS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT

SS



GGGTTS
S


STT
B
 .........220.........230.........240.........250.........260.........270.........280
Sequence TNPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGA
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)



TTTS

TTBTT

SB
BB
TT





S
SSS

GGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence RAMQEAIKDAGIAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHKLAVSSTKSMTGHLLGAAGGIEA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T

GGG





S
GGGGGTS
T
B
GGG
 .........360.........370.........380.........390.........400.........410...
Sequence IFSILAIKEGVIPPTINIQTPDEECDLDYVPDEARRQELNYVLSNSLGFGGHNATLIFKKYQS
Predicted secondary structure




































SS confidence






























































Known secondary structure (DSSP) T

B



SBBTTB
S


BSS



STTT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D