Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4lihG_

Fold library idPDB HeaderMoleculeTitle
c4lihG_PDB header: oxidoreductaseChain: G: PDB Molecule: gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase;PDBTitle: the crystal structure of gamma-glutamyl-gamma-aminobutyraldehyde2 dehydrogenase from burkholderia cenocepacia j2315


Added to library: Sat Aug 3 08:52:03 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTLADWQHKAASLEIEGRAFIDGASRDAHGGRTFDCVSPIDGRVLAKVADCGEADVNAAVAAARRAFDAG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)






STT

TT


TTT




T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPIGDTTTVDVPGAAYCVEWFAEAIDKVGGEVA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTS
T


TTTTTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence PADHHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEAGIP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


TT
S

SSSTT


TT

T

 .........220.........230.........240.........250.........260.........270.........280
Sequence AGVFNVVPGAGEPGKLLALHRDVDCIAFTGSTAVGKLIMQYAAQSNLKRAWLELGGKSPNIVLPDCPDLD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT


S
TT

S
TT







TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVSMGAIVDGIQLERVL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGG

TT


TTTGGG
B

TTSTT
SB


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence GYIEAGRGEGRLVTGGARVNAETGGFYVEPTVFEVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S



GGGTS




TTSS


SSSS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence YGLAAAVWTSNLTTAHDVSRRLRAGTVWVNCYDEGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

S
S


SSS
SS



TTS
B

SGGGS
BSSGGGGGGG
 ...
Sequence RLR
Predicted secondary structure

SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D