Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4lihG_

Fold library idPDB HeaderMoleculeTitle
c4lihG_PDB header: oxidoreductaseChain: G: PDB Molecule: gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase;PDBTitle: the crystal structure of gamma-glutamyl-gamma-aminobutyraldehyde2 dehydrogenase from burkholderia cenocepacia j2315


Added to library: Sat Aug 3 08:52:03 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LTLADWQHKAASLEIEGRAFIDGASRDAHGGRTFDCVSPIDGRVLAKVADCGEADVNAAVAAARRAFDAG
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)






STT

TT


TTT




T
 .........80.........90.........100.........110.........120.........130.........140
Sequence VWAGLNPRARKAVLLRWAALMREHLDELSLLETLDAGKPIGDTTTVDVPGAAYCVEWFAEAIDKVGGEVA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTTTS
T


TTTTTT



 .........150.........160.........170.........180.........190.........200.........210
Sequence PADHHLVGLVTREPVGVVAAVVPWNFPILMAAWKFGPALAAGNSVVLKPSEKSPLTAIRVAQLAFEAGIP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


TT
S

SSSTT


TT

T

 .........220.........230.........240.........250.........260.........270.........280
Sequence AGVFNVVPGAGEPGKLLALHRDVDCIAFTGSTAVGKLIMQYAAQSNLKRAWLELGGKSPNIVLPDCPDLD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTT


S
TT

S
TT







TT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RAAQTAAGAIFYNMGEMCTAGSRLLVHRDIKDAFIEKLVAAARAYVPGNPLDPSVSMGAIVDGIQLERVL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GGGG

TT


TTTGGG
B

TTSTT
SB


S
 .........360.........370.........380.........390.........400.........410.........420
Sequence GYIEAGRGEGRLVTGGARVNAETGGFYVEPTVFEVKPDAKIAREEIFGPVLSVIVFDDVDEAVRIANDTE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S



GGGTS




TTSS


SSSS
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence YGLAAAVWTSNLTTAHDVSRRLRAGTVWVNCYDEGGDMNFPFGGYKQSGNGRDKSLHALEKYTELKSTLI
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

S
S


SSS
SS



TTS
B

SGGGS
BSSGGGGGGG
 ...
Sequence RLR
Predicted secondary structure

SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D