Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ldrA_

Fold library idPDB HeaderMoleculeTitle
c4ldrA_PDB header: isomerase, cell invasionChain: A: PDB Molecule: methylthioribose-1-phosphate isomerase;PDBTitle: structure of the s283y mutant of mrdi


Added to library: Sat Aug 3 08:28:26 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGPG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


STT
GGGTTT




TT
S
STTT
S
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDNR
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) STT
TTSTSTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence SIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGARL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
TT



S

STTTSSSS
STT


TTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TAFELVYEQIPATLITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT


GGGS




STT

TTTT



 .........290.........300.........310.........320.........330.........340.........350
Sequence SYSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRT
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) GGGTT
SSGGG



B

TTT
S
TT




BS
GGG

STT
 ...
Sequence ALT
Predicted secondary structure
SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D