Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4kzkA_

Fold library idPDB HeaderMoleculeTitle
c4kzkA_PDB header: sugar binding proteinChain: A: PDB Molecule: l-arabinose abc transporter, periplasmic l-arabinose-PDBTitle: the structure of the periplasmic l-arabinose binding protein from2 burkholderia thailandensis


Added to library: Sat Jun 29 08:48:03 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VKIGFVVKQPDDPWFQDEWRFAEQAAKDKHFTLVKIAAPSGEKVSTALDSLAAQKAQGVIICAPDVKLGP
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
S
TTST


STT
S
SSGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence GIAAKAKRYGMKLMSVDDQLVDGRGAPLADVPHMGISAYRIGRQVGDAIAAEAKRRGWNPAEVGVLRLAY
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TT
SS

B
TTS
B
TTS

TT

GGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence DQLPTARERTTGAVDALKAAGFAAANVVDAPEMTADTEGAFNAANIAFTKHRNFRHWVAFGSNDDTTVGA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTSTT

GGG
SSSS
TT
SS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence VRAGEGRGIGTDDMIAVGINGSQVALNEFAKPKPTGFFGSILLNPRLHGYDTSVNMYDWITQNRTPPPLV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TT

GGG
SSSS

S






S
 .........290.........300.
Sequence LTSGTLITRANEKTARAQLGL
Predicted secondary structure






SS confidence




















Known secondary structure (DSSP)

TTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D