Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4kt1A_

Fold library idPDB HeaderMoleculeTitle
c4kt1A_PDB header: hormone receptor/cell adhesionChain: A: PDB Molecule: leucine-rich repeat-containing g-protein coupled receptorPDBTitle: complex of r-spondin 1 with lgr4 extracellular domain


Added to library: Sat Jun 22 10:44:06 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSF
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP)




TT

STT

SS

SS


S

TT



SS



TTTTTT
TT
S
TTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence IHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSL
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT



SS


B

TTTTTT
TT



SS


B

TTTTTT
TT



SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence TEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S

TT
TT



SS



TTTTTT
TT



SS



TTTTTT
TT



SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence NLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


S

GGGGG
TT



SS



TTTTTT
TT



SS



TTTT
S
TT


 .........290.........300.........310.........320.........330.........340.........350
Sequence ASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

S



TT



SSS





TT
SS



SS


S



TT
TT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence QIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNF
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)



TTTTTT
TT



SS



TTTTTT
SS



SS

S



TT
TT
S
TT
T
 .........430.........440.........450.........460.
Sequence KLKEALAAKDFVNLRSLSVPYAYQCCAFWGCIHCTPSTGHH
Predicted secondary structure
































SS confidence








































Known secondary structure (DSSP) T





GGGGTT


SSGGGGTTTS





TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D