Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4k9qB_

Fold library idPDB HeaderMoleculeTitle
c4k9qB_PDB header: lyaseChain: B: PDB Molecule: benzoylformate decarboxylase;PDBTitle: the crystal structure of benzoylformate decarboxylase from2 polynucleobacter necessarius


Added to library: Sat Apr 26 08:31:17 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RTVKEITFDLLRKLQVTTVVGNPGSTEETFLKDFPSDFNYVLALQEASVVAIADGLSQSLRKPVIVNIHT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
BT




GGGTT

TTS
SSTS


 .........80.........90.........100.........110.........120.........130.........140
Sequence GAGLGNAMGCLLTAYQNKTPLIITAGQQTREMLLNEPLLTNIEAINMPKPWVKWSYEPARPEDVPGAFMR
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TT




TTTGGG

TT

TTGGGTTTTS
S


SSGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence AYATAMQQPQGPVFLSLPLDDWEKLIPEVDVARTVSTRQGPDPDKVKEFAQRITASKNPLLIYGSDIARS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) SSS


GGGTT
B

















SS

TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence QAWSDGIAFAERLNAPVWAAPFAERTPFPEDHPLFQGALTSGIGSLEKQIQGHDLIVVIGAPVFRYYPWI
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) T
T


TT
SS

S
TTSTT

SSTTT
SSS
S



S

 .........290.........300.........310.........320.........330.........340.........350
Sequence AGQFIPEGSTLLQVSDDPNMTSKAVVGDSLVSDSKLFLIEALKLIDQREKNNTPQRSPMTKEDRTAMPLR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
S
SS
TT
S
T
SSS

TT


















TT
SSB
 .........360.........370.........380.........390.........400.........410.........420
Sequence PHAVLEVLKENSPKEIVLVEECPSIVPLMQDVFRINQPDTFYTFASGGLGWDLPAAVGLALGEEVSGRNR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T

SS

GGG



STT


SS

TTSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence PVVTLMGDGSFQYSVQGIYTGVQQKTHVIYVVFQNEEYGILKQFAELEQTPNVPGLDLPGLDIVAQGKAY
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTTT


SB
TT



SS
B

S

T
 .........500.........510.........520.........530
Sequence GAKSLKVETLDELKTAYLEALSFKGTSVIVVPITKELKPL
Predicted secondary structure















SS confidence







































Known secondary structure (DSSP) T


SSSSB
S





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D