Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4jp0A_

Fold library idPDB HeaderMoleculeTitle
c4jp0A_PDB header: toxinChain: A: PDB Molecule: 43.8 kda insecticidal crystal protein;PDBTitle: crystal structure of cry35ab1


Added to library: Sat Apr 26 08:16:08 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LDTNKVYEISNHANGLYAATYLSLDDSGVSLMNKNDDDIDDYNLKWFLFPIDDDQYIITSYAANNCKVWN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SSTTT

TT
TT
B

TT
TTGGG

TTTTTSGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence VNNDKINVSTYSSTNSIQKWQIKANGSSYVIQSDNGKVLTAGTGQALGLIRLTDESSNNPNQQWNLTSVQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT


TT
GGG
TTTTS


GGGTT



SS
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence TIQLPQKPIIDTKLKDYPKYSGNIDNGTSPQLMGWTLVPCIMVNDPNIDKNTQIKTTPYYILKKYQYWQR
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)










S











SB


GGG


TTS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence AVGSNVALRPHEKKSYTYEWGTEIDQKTTIINTLGFQINIDSGMKFDIPEVGGGTDEIKTQLNEELKIEY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TT


TT

S
STTTSBTTS



SSS

SGGGT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence SHETKIMEKYQEQSEIDNPTDQSMNSIGFLTITSLELYRYNGSEIRIMQIQTSDNDTYNVTSYPNHQQAL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S
SSB


SSS
SSS
GGG
S
 .........360.........370........
Sequence LLLTNHSYEEVEEITNIPKSTLIKLKKH
Predicted secondary structure







SS confidence



























Known secondary structure (DSSP) TTSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D