Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4jp0A_

Fold library idPDB HeaderMoleculeTitle
c4jp0A_PDB header: toxinChain: A: PDB Molecule: 43.8 kda insecticidal crystal protein;PDBTitle: crystal structure of cry35ab1


Added to library: Sat Apr 26 08:16:08 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LDTNKVYEISNHANGLYAATYLSLDDSGVSLMNKNDDDIDDYNLKWFLFPIDDDQYIITSYAANNCKVWN
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SSTTT

TT
TT
B

TT
TTGGG

TTTTTSGGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence VNNDKINVSTYSSTNSIQKWQIKANGSSYVIQSDNGKVLTAGTGQALGLIRLTDESSNNPNQQWNLTSVQ
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TT


TT
GGG
TTTTS


GGGTT



SS
GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence TIQLPQKPIIDTKLKDYPKYSGNIDNGTSPQLMGWTLVPCIMVNDPNIDKNTQIKTTPYYILKKYQYWQR
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)










S











SB


GGG


TTS

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence AVGSNVALRPHEKKSYTYEWGTEIDQKTTIINTLGFQINIDSGMKFDIPEVGGGTDEIKTQLNEELKIEY
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
TT


TT

S
STTTSBTTS



SSS

SGGGT

B
 .........290.........300.........310.........320.........330.........340.........350
Sequence SHETKIMEKYQEQSEIDNPTDQSMNSIGFLTITSLELYRYNGSEIRIMQIQTSDNDTYNVTSYPNHQQAL
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S
SSB


SSS
SSS
GGG
S
 .........360.........370........
Sequence LLLTNHSYEEVEEITNIPKSTLIKLKKH
Predicted secondary structure







SS confidence



























Known secondary structure (DSSP) TTSS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D