Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4jmgA_

Fold library idPDB HeaderMoleculeTitle
c4jmgA_PDB header: de novo proteinChain: A: PDB Molecule: clamp ptpn11_py580;PDBTitle: crystal structure of the synthetic protein in complex with py peptide


Added to library: Sat Apr 26 08:44:35 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VKFNSLNELVDYHRSTSVSRNQQIFLRDIGGHPWYKGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

BSSTTTS
S
SSS







SSB
SS

T
SSTT
SSSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSVKFGNDVQHFKVLRDGAGKYFLWVGGSGGSVSSVPTKLEVVAATPTSLLISWDAWSGSDWPVSYYRIT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

TTS
SS


SSSSTT
SSS


SS

TT


TTS

S
 .........150.........160.........170.........180.........190.......
Sequence YGETGGNSPVQEFTVPGSSYTATISGLSPGVDYTITVYAGYDGKYYYQSPISINYRT
Predicted secondary structure



























SS confidence
























































Known secondary structure (DSSP) TT
SS

TT





TT
BSSSS
B
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D