Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4jmgA_

Fold library idPDB HeaderMoleculeTitle
c4jmgA_PDB header: de novo proteinChain: A: PDB Molecule: clamp ptpn11_py580;PDBTitle: crystal structure of the synthetic protein in complex with py peptide


Added to library: Sat Apr 26 08:44:35 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VKFNSLNELVDYHRSTSVSRNQQIFLRDIGGHPWYKGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFS
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)

BSSTTTS
S
SSS







SSB
SS

T
SSTT
SSSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSVKFGNDVQHFKVLRDGAGKYFLWVGGSGGSVSSVPTKLEVVAATPTSLLISWDAWSGSDWPVSYYRIT
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT

TTS
SS


SSSSTT
SSS


SS

TT


TTS

S
 .........150.........160.........170.........180.........190.......
Sequence YGETGGNSPVQEFTVPGSSYTATISGLSPGVDYTITVYAGYDGKYYYQSPISINYRT
Predicted secondary structure



























SS confidence
























































Known secondary structure (DSSP) TT
SS

TT





TT
BSSSS
B
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D