Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4j7zC_

Fold library idPDB HeaderMoleculeTitle
c4j7zC_PDB header: chaperoneChain: C: PDB Molecule: chaperone protein dnaj 2;PDBTitle: thermus thermophilus dnaj j- and g/f-domains


Added to library: Sat Aug 3 08:33:41 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAKKDYYAILGVPRNATQEEIKRAYKRLARQYHPDVNKSPEAEEKFKEINEAYAVLSDPEKRRIYDTYGT
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




T

TT

STTT


TSTTS
 .........80.........90.........100...
Sequence TEAPPPPPPGGYDFSGFDVEDFSEFFQELFGPG
Predicted secondary structure
























SS confidence
































Known secondary structure (DSSP) SS





TT



TTS
GGGS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D