Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4is4G_

Fold library idPDB HeaderMoleculeTitle
c4is4G_PDB header: ligaseChain: G: PDB Molecule: glutamine synthetase;PDBTitle: the glutamine synthetase from the dicotyledonous plant m. truncatula2 is a decamer


Added to library: Sat Apr 12 08:20:44 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSLLSDLINLNLSESSEKIIAEYIWVGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTNQAPGQDSEV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP)
T

GGGT
S

TTSS
SS



GGGS

GGGTTS

SS

 .........80.........90.........100.........110.........120.........130.........140
Sequence ILYPQAIFKDPFRQGNNILVICDVYTPAGEPLPTNKRYNAAKIFSHPDVAAEVPWYGIEQEYTLLQKDTN
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
TTT
TT

TTS
B
TT

STT

TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence WPLGWPIGGYPGPQGPYYCGIGADKAYGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISA
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) SBTT

TT



SSSS
TT

STTT


T


SSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GDEIWAARYILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMRENGGYEIIKKAIEKLGLRHSVR
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

SS
SSS








STT
S

 .........290.........300.........310.
Sequence VGYFEDRRPSSNMDPYVVTSMIAETTLLWKP
Predicted secondary structure













SS confidence






























Known secondary structure (DSSP)






TTS
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D