Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4irqB_

Fold library idPDB HeaderMoleculeTitle
c4irqB_PDB header: transferaseChain: B: PDB Molecule: beta-1,4-galactosyltransferase 7;PDBTitle: crystal structure of catalytic domain of human beta1,2 4galactosyltransferase 7 in closed conformation in complex with3 manganese and udp


Added to library: Sat Sep 28 08:22:35 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTD
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)



S
SS
TT

SSS


S
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence YIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGRE
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
TT


TTS

S

TTS
TT
TTT
SS

STT


STTS

S


SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence DDEFYRRIKGAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


B


S



TTS



TTTS






TTTTS


S
STTT

 .........220.........230.........240
Sequence TALSVGGAPCTVLNIMLDCDKTATPWCTFS
Predicted secondary structure














SS confidence





























Known secondary structure (DSSP) TT


TTT
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D