Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hx3H_

Fold library idPDB HeaderMoleculeTitle
c4hx3H_PDB header: hydrolase/hydrolase inhibitorChain: H: PDB Molecule: neutral proteinase inhibitor scnpi;PDBTitle: crystal structure of streptomyces caespitosus sermetstatin in complex2 with s. caespitosus snapalysin


Added to library: Thu Jan 10 08:05:05 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GSAHGPSAMVFTVIQGSGEPTDTVLRATTLSCAYTAEGTHPAPRAACDALNATDGELNRLLLVCPMYFDP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)





SS

TT

SSSSS
SSTTT
GGGG









 .........80.........90.........100........
Sequence VTVTADGVLNGRRVAWKHTFSNTCVMSANLNSNPVYAF
Predicted secondary structure












SS confidence





































Known secondary structure (DSSP) TTSSTTS
GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D