Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hqfA_

Fold library idPDB HeaderMoleculeTitle
c4hqfA_PDB header: cell adhesionChain: A: PDB Molecule: thrombospondin-related anonymous protein, trap;PDBTitle: crystal structure of plasmodium falciparum trap, i4 form


Added to library: Wed Jan 9 16:46:41 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EVCNDEVDLYLLMDGSGSIRRHNWVNHAVPLAMKLIQQLNLNDNAIHLYASVFSNNAREIIRLHSDASKN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

S
S




SSTTT



TTSTT
SS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KEKALIIIKSLLSTNLPYGKTSLTDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLSD
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TTGGG
S

TS


TT
SS

S
 .........150.........160.........170.........180.........190.........200
Sequence RGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK
Predicted secondary structure























SS confidence



























































Known secondary structure (DSSP) TT
SSS

TTS
SSSS

TT
GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D