Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hq1A_

Fold library idPDB HeaderMoleculeTitle
c4hq1A_PDB header: transferaseChain: A: PDB Molecule: probable receptor protein kinase tmk1;PDBTitle: crystal structure of an lrr protein with two solenoids


Added to library: Sat Jun 8 09:46:32 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSDGDLSAMLSLKKSLNPPSSFGWSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)



TTSS

SSSGGGSTT
TT


TTS


SB

GGGGG
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence ELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNPFKSWEIPESLRNASALQ
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP)

SS





TT
TT



SS

TTTTTT
TT



S



SB


GGGGG
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence NFSANSANVSGSLPGFLGPDEFPGLSILHLAFNNLEGELPMSLAGSQVQSLWLNGQKLTGDITVLQNMTG
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TTS
B

GGGSTTT
TT


TTS

GGGTT


S

SS

GGGGG
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LKEVWLHSNKFSGPLPDFSGLKELESLSLRDNSFTGPVPASLLSLESLKVVNLTNNHLQGPVPVFKSSVS
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
S

SS



TT
TT



SS


T
TT



SS
SS




TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence VDLDKDSNSFCLSSPGECDPRVKSLLLIASSFDYPPRLAESWKGNDPCTNWIGIACSNGNITVISLEKME
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)

TTSS

SSSSSS


TT

S
SS
TTSS
TTTT
TTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence LTGTISPEFGAIKSLQRIILGINNLTGMIPQELTTLPNLKTLDVSSNKLFGKVPGFRSNVVVNTNGNPDI
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)

S


GGGGG
TT



SS


S


GGGGG
TT



SS







TT

TT
T
 ....
Sequence GKDK
Predicted secondary structure



SS confidence



Known secondary structure (DSSP) T



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D