Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hg6B_

Fold library idPDB HeaderMoleculeTitle
c4hg6B_PDB header: transferaseChain: B: PDB Molecule: cellulose synthase subunit b;PDBTitle: structure of a cellulose synthase - cellulose translocation2 intermediate


Added to library: Thu Jan 10 10:59:05 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PWIIPLRPLAETAQVGPLFRLQGQQARAAFRLFLPTEAVGGTLTLAQRSSIDILPESSQIIVRMNDQEIG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SSS


SS

TT
S
SS

TT

BB

SS


BTTBTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RFTPRQFGALGAVTMPLGEAVRAGDNLVTIEAQHRHRIYCGADAEFDLWTEVDLSQSGVALPAAAIGTEP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




SS


B




SSS
SS


SS

ST

GGG

TTSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TSFIAALTAQAESGRPVEIRTPTPPDEATLRTLAQALGRPLPDEALPLALSKPWSAETGPTYARITLLPS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TSS

SS


SSSTT




TT


SS

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence DADRVSIRRGGDGAVVLVLEHPPEGSPNASLVADLLGATPTLPPPTLPQIPPGRVVTLADMGVDTILTDN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
SSTT
TTS


SSS








B

SS

B
STTTT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RYFNRDIDFQLPDDWLLLASQKAQIGIDYGFAGGLPEGALLLVKVNGTTVRMLPLDRDAAPVKPRLDIRF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S

SS



SS


SS

TT
TTSSS

BSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence PARLLHPGPNRLSFESVIPGNPPDQPCPASAGDLMQVLSSTDLEVPPSPRMQMADMARDLAQVTPASVHP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GGG

SS


SSSSS




SS


S







S


TT

GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence ATPDGLARTLPFMAAFREVPDAAPVDLTVAGLHDIATVPLNEEGLTPRLLALTLLPSTGPPANALAPLGA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SSGGGS


TT



TGGGSS



SSS

SSSS







S

TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence APGEGVMPPLVESNWSDRAQTFVQATLQPVIQTVRRMLRPGDGNLAEWLATRKGTAMLLAPEPGKLWVIL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SS
SS




TT
T

SS
TTT


S

TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence GPEAEPARVAEALAMAPRSPGGPRGQVAVLGSDGRWSSWSKPGLLPELREPVSLDNVRSVVGNVASARPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT

GGGSTTS

BS
TTS

B

SS


SS


S
 .........640.........650.....
Sequence LLLGGMLGLAWISAAIAVGFVLRTR
Predicted secondary structure

SS confidence
























Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D