Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hg6B_

Fold library idPDB HeaderMoleculeTitle
c4hg6B_PDB header: transferaseChain: B: PDB Molecule: cellulose synthase subunit b;PDBTitle: structure of a cellulose synthase - cellulose translocation2 intermediate


Added to library: Thu Jan 10 10:59:05 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PWIIPLRPLAETAQVGPLFRLQGQQARAAFRLFLPTEAVGGTLTLAQRSSIDILPESSQIIVRMNDQEIG
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SSS


SS

TT
S
SS

TT

BB

SS


BTTBTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RFTPRQFGALGAVTMPLGEAVRAGDNLVTIEAQHRHRIYCGADAEFDLWTEVDLSQSGVALPAAAIGTEP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)




SS


B




SSS
SS


SS

ST

GGG

TTSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TSFIAALTAQAESGRPVEIRTPTPPDEATLRTLAQALGRPLPDEALPLALSKPWSAETGPTYARITLLPS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TSS

SS


SSSTT




TT


SS

S

 .........220.........230.........240.........250.........260.........270.........280
Sequence DADRVSIRRGGDGAVVLVLEHPPEGSPNASLVADLLGATPTLPPPTLPQIPPGRVVTLADMGVDTILTDN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
SSTT
TTS


SSS








B

SS

B
STTTT



S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RYFNRDIDFQLPDDWLLLASQKAQIGIDYGFAGGLPEGALLLVKVNGTTVRMLPLDRDAAPVKPRLDIRF
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) S

SS



SS


SS

TT
TTSSS

BSS


 .........360.........370.........380.........390.........400.........410.........420
Sequence PARLLHPGPNRLSFESVIPGNPPDQPCPASAGDLMQVLSSTDLEVPPSPRMQMADMARDLAQVTPASVHP
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) GGG

SS


SSSSS




SS


S







S


TT

GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence ATPDGLARTLPFMAAFREVPDAAPVDLTVAGLHDIATVPLNEEGLTPRLLALTLLPSTGPPANALAPLGA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) SSGGGS


TT



TGGGSS



SSS

SSSS







S

TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence APGEGVMPPLVESNWSDRAQTFVQATLQPVIQTVRRMLRPGDGNLAEWLATRKGTAMLLAPEPGKLWVIL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SS
SS




TT
T

SS
TTT


S

TTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence GPEAEPARVAEALAMAPRSPGGPRGQVAVLGSDGRWSSWSKPGLLPELREPVSLDNVRSVVGNVASARPP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
TT

GGGSTTS

BS
TTS

B

SS


SS


S
 .........640.........650.....
Sequence LLLGGMLGLAWISAAIAVGFVLRTR
Predicted secondary structure

SS confidence
























Known secondary structure (DSSP) T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D